PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 137aa    MW: 15430.4 Da    PI: 4.4249
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020232.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB66.36e-212731485
        NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                 ++i+k++lP + ++++da++++ ec +efi +++se+++ c re+++ti+++ ++ al  lGf +y+e++  
  Pbr020232.1  2 TKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIAPEHVIKALQVLGFSEYIEEVYS 73
                 68*****************************************************************98754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.69E-302122IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.5E-332121IPR009072Histone-fold
PfamPF008083.9E-18259IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE VCSREEKRTI APEHVIKALQ  60
VLGFSEYIEE VYSAYEQHKL ETMHDLSKSV KWGNGTEMTE EEALAEQQRM FAEARARMNG  120
GATAPKQPDP EQSLES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-30111521133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346631.14e-98PREDICTED: protein Dr1 homolog
SwissprotP495924e-78NC2B_ARATH; Protein Dr1 homolog
TrEMBLM5WVN39e-96M5WVN3_PRUPE; Uncharacterized protein
STRINGGLYMA05G07750.13e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.22e-79nuclear factor Y, subunit B13